PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00696.1.g00180.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 292aa    MW: 32599.2 Da    PI: 6.5094
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00696.1.g00180.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding574.6e-183582148
                                    TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                 Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                    rg+WT +Ed+ lv++++++G g+W++ ar  g++Rt+k+c++rw++yl
  Zmw_sc00696.1.g00180.1.sm.mkhc 35 RGPWTVDEDLTLVNYIAEHGDGRWNALARAAGLKRTGKSCRLRWLNYL 82
                                    89********************************************97 PP

2Myb_DNA-binding52.21.4e-1688131146
                                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
                 Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                     rg +T++E++l++d++ ++G++ W++Ia+ ++ gRt++++k++w++
  Zmw_sc00696.1.g00180.1.sm.mkhc  88 RGDFTADEQLLILDLHSRWGNR-WSKIAQQLP-GRTDNEIKNYWRT 131
                                     899*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.7993082IPR017930Myb domain
SuperFamilySSF466895.62E-3033129IPR009057Homeodomain-like
SMARTSM007178.9E-153484IPR001005SANT/Myb domain
PfamPF002491.6E-163582IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-223689IPR009057Homeodomain-like
CDDcd001671.19E-103782No hitNo description
PROSITE profilePS5129423.16583137IPR017930Myb domain
SMARTSM007171.5E-1487135IPR001005SANT/Myb domain
PfamPF002493.8E-1588131IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-2390135IPR009057Homeodomain-like
CDDcd001672.53E-1091131No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MEMALQQRGS SSSRPGSATQ PTAMKKEQEE EELRRGPWTV DEDLTLVNYI AEHGDGRWNA  60
LARAAGLKRT GKSCRLRWLN YLRPDVKRGD FTADEQLLIL DLHSRWGNRW SKIAQQLPGR  120
TDNEIKNYWR TRVQKHARQL NCDVNSRRFK DAMIYLAQRA AAASQCNSQS QQHPVFLAGG  180
DSSNVANKSS ASSCDLSAVL TTAATPPPAA CSSSSDSSLT STESAHEEKS VLHLPNAGGC  240
WPTMQSANHE FWDLQELNVD MPDLTGWVQG FSEGIPDADH SLWSLEDIWR MQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C8e-263213524126MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015618000.12e-98PREDICTED: transcription factor MYB108
TrEMBLQ9ARI83e-98Q9ARI8_ORYSA; Myb transcription factor JAMyb
TrEMBLA0A0E0RC243e-98A0A0E0RC24_ORYRU; Uncharacterized protein
TrEMBLQ2QZJ83e-98Q2QZJ8_ORYSJ; Expressed protein
STRINGLOC_Os11g45740.17e-98(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330